PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G34370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 410aa    MW: 43997.1 Da    PI: 6.5081
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G34370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-18108153147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W+ +Ed ll ++v++lG+++W++Iar ++ gR++k+c++rw + 
  OMERI01G34370.1 108 KGPWSSDEDTLLSNLVEKLGPRNWTLIARGIP-GRSGKSCRLRWCNQ 153
                      79******************************.***********985 PP

2Myb_DNA-binding54.62.5e-17160204147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eEd +++ a++ +G++ W++Ia+ +  gRt++ +k++w++ 
  OMERI01G34370.1 160 RKPFTEEEDRIIIAAHAIHGNK-WAAIAKLLV-GRTDNAIKNHWNST 204
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.192103154IPR017930Myb domain
SuperFamilySSF466897.55E-30106201IPR009057Homeodomain-like
SMARTSM007171.2E-14107156IPR001005SANT/Myb domain
PfamPF002495.5E-17108153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-25109161IPR009057Homeodomain-like
CDDcd001677.33E-14110152No hitNo description
PROSITE profilePS5129426.647155209IPR017930Myb domain
SMARTSM007174.6E-17159207IPR001005SANT/Myb domain
PfamPF002493.0E-15160204IPR001005SANT/Myb domain
CDDcd001676.24E-13162205No hitNo description
Gene3DG3DSA:1.10.10.605.9E-24162208IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MSSETAASPP PPPNPPAADS AHSSPASMTD ETHGAGAHPD ESQPHRSSSS SSSPPVAGET  60
RVPLPVRSLP QPSYPSPPPS GEDEDDVVIT GQIAVGDAAG AAMEERVKGP WSSDEDTLLS  120
NLVEKLGPRN WTLIARGIPG RSGKSCRLRW CNQLDPQVKR KPFTEEEDRI IIAAHAIHGN  180
KWAAIAKLLV GRTDNAIKNH WNSTLRRRHC TGGRCTQGGV MERAIPERPR SVSEEPWPLG  240
NLSSLNVREA MEAPAQTVSE SYVGAWQIGD QSCKTEVVDP PYLARPVAKV GAFKPYNVGP  300
AQSSQKEMLS FATKFDSNLH PFKPENGVCK FVDPTSFAAE VPNKCGHGCC SSHGQLRKNS  360
LLGPEFNEFE DHPPISDSSF ASLVSEISSI AWMKSGLQSS DTLARSVPPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-401072086107B-MYB
1gv2_A6e-401052081104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1085820.0AK108582.1 Oryza sativa Japonica Group cDNA clone:002-146-A03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630688.10.0PREDICTED: transcription factor RAX1
TrEMBLA0A0E0CAC50.0A0A0E0CAC5_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g63160.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.12e-78myb domain protein 109